PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000180605
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 274aa    MW: 31434.1 Da    PI: 6.5208
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000180605genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.74e-5291361128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    l+pGfrFhPtdeelv++yLk+kv+gk++++ + i+  diyk+ePwdLp k k+k+++ ewyfFs  dkky +++r+n at++gyWk+tgkd++v++
  MDP0000180605   9 LAPGFRFHPTDEELVWYYLKRKVSGKNFRF-DPISVXDIYKTEPWDLPgKsKLKTRDLEWYFFSFLDKKYGNSSRTNXATEKGYWKTTGKDRPVKH 103
                    579**************************9.89***************5347777888************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+kktLvf++grap g +t+Wvmheyrl
  MDP0000180605 104 -NSRDVGMKKTLVFHSGRAPXGARTNWVMHEYRL 136
                    .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-606160IPR003441NAC domain
PROSITE profilePS5100555.939160IPR003441NAC domain
PfamPF023651.2E-2711136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MARGKENSLA PGFRFHPTDE ELVWYYLKRK VSGKNFRFDP ISVXDIYKTE PWDLPGKSKL  60
KTRDLEWYFF SFLDKKYGNS SRTNXATEKG YWKTTGKDRP VKHNSRDVGM KKTLVFHSGR  120
APXGARTNWV MHEYRLSNEE LEKAGIQQKD PYVLCRIFQK SGTGPKNGEK YGAPVMEEEW  180
DDDDVTCVPG EEAAADVVAL SXEPHVEAIX VNDGAYVEAF DLDQVLNSFS FFISCPVVDE  240
LXDMGMGRFX XNVLXIKITV HLXETYRCVM ISQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-46816619174NAC domain-containing protein 19
3swm_B3e-46816619174NAC domain-containing protein 19
3swm_C3e-46816619174NAC domain-containing protein 19
3swm_D3e-46816619174NAC domain-containing protein 19
3swp_A3e-46816619174NAC domain-containing protein 19
3swp_B3e-46816619174NAC domain-containing protein 19
3swp_C3e-46816619174NAC domain-containing protein 19
3swp_D3e-46816619174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.38570.0bud| cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008345397.11e-160PREDICTED: NAC domain-containing protein 78-like
SwissprotQ84K001e-103NAC78_ARATH; NAC domain-containing protein 78
TrEMBLD9ZJA81e-160D9ZJA8_MALDO; NAC domain class transcription factor
STRINGPOPTR_0008s03170.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-105NAC domain containing protein 2